Basic Information | |
---|---|
Taxon OID | 3300012941 Open in IMG/M |
Scaffold ID | Ga0162652_100022797 Open in IMG/M |
Source Dataset Name | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Shell Corporation |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 888 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Ranch near Red Deer, Alberta, Canada | |||||||
Coordinates | Lat. (o) | 52.172047 | Long. (o) | -113.738964 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F035662 | Metagenome / Metatranscriptome | 171 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0162652_1000227971 | F035662 | N/A | CDTNLGVLFERDAEDDSPTLDFLPHDDCWHVSRQQLVENLEALHSGESSLPVSLKRIAAGARQLSLSERPVAS* |
⦗Top⦘ |