Scaffold Ga0162650_100000903

Overview

Basic Information

• Taxon OID: 3300012939
• Scaffold ID: Ga0162650_100000903
• Source Dataset Name: Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Shell Corporation
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2641
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (80.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations

Source Dataset Sampling Location

• Location Name: Ranch near Red Deer, Alberta, Canada
• Coordinates
  • Lat. (^o): 52.172047
  • Long. (^o): -113.738964
  • Depth (m): .15

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040724	Metagenome / Metatranscriptome	161	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0162650_1000009031	F040724	N/A	MPRCQVAHSLSKITVIVAAVALSGTGACAGRLGDTSQLVERLCRPFGIGLRQFERCLLHERRGDRLAISSAFLEIDRHCPIERK*