Scaffold Ga0163109_10001899

Overview

Basic Information

• Taxon OID: 3300012936
• Scaffold ID: Ga0163109_10001899
• Source Dataset Name: Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 16419
• Total Scaffold Genes: 31
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 12 (38.71%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater → Marine Microbial Communities From The Costa Rica Dome And Surrounding Waters

Source Dataset Sampling Location

• Location Name: Costa Rica: the Eastern Pacific
• Coordinates
  • Lat. (^o): 9.5025
  • Long. (^o): -92.3286
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028778	Metagenome / Metatranscriptome	190	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0163109_1000189929	F028778	N/A	MTYDWTLLQTLVFIITPYFIMLALSSKDEDDDDMGPGMMMPATNPT*