Scaffold Ga0153915_10134044

Overview

Basic Information

• Taxon OID: 3300012931
• Scaffold ID: Ga0153915_10134044
• Source Dataset Name: Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2668
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (20.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands → Freshwater Wetland Microbial Communities From Ohio, Usa, Analyzing The Effect Of Biotic And Abiotic Controls

Source Dataset Sampling Location

• Location Name: USA: Ohio, Lake Erie, Old Woman Creek
• Coordinates
  • Lat. (^o): 41.3778
  • Long. (^o): -82.5108
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090135	Metagenome / Metatranscriptome	108	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0153915_101340443	F090135	AGAAGG	MGAKGLFLMGALAFWLPELILYAWTRHGLNGKLVTFLLPSCLLVTYLLVSILRPKGVAKPSASIFMALGVLFLGTFAMALGSTLRGAGFLENPGSTLVGVLLGTVIPIYAFIAATYDGSLYALVSVSLLMPMLHLIFERQNWIIRPKKAAAEPMSGG*