Scaffold Ga0163110_10534119

Overview

Basic Information

• Taxon OID: 3300012928
• Scaffold ID: Ga0163110_10534119
• Source Dataset Name: Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 898
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (40.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage Mosig EXVC030M (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater → Marine Microbial Communities From The Costa Rica Dome And Surrounding Waters

Source Dataset Sampling Location

• Location Name: Costa Rica: the Eastern Pacific
• Coordinates
  • Lat. (^o): 2.0416
  • Long. (^o): -97.0511
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021990	Metagenome / Metatranscriptome	216	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0163110_105341194	F021990	N/A	MKLKETIMIAIAGLAFMLMTGIAKANPITNWITNEKNKIVEYQTANWAKGKEQLNNTKQSILNLFKKKNDTQD*