Scaffold Ga0137416_10426223

Overview

Basic Information

• Taxon OID: 3300012927
• Scaffold ID: Ga0137416_10426223
• Source Dataset Name: Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1129
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon 13_1_40CM_2_52_13 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil → Vadose Zone Soil And Rhizosphere Microbial Communities From The Eel River Critical Zone Observatory, Northern California To Study Diel Carbon Cycling

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 39.7291
  • Long. (^o): -123.6419

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018143	Metagenome / Metatranscriptome	236	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0137416_104262233	F018143	N/A	MREKAFAVISSEAKNRGVTVQELLRAVIVPEWARENLQHTVPQTSMQITPHQIKPSMSPKQRDSKLAITVGQLRT*