Scaffold Ga0160422_10025151

Overview

Basic Information

• Taxon OID: 3300012919
• Scaffold ID: Ga0160422_10025151
• Source Dataset Name: Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3445
• Total Scaffold Genes: 10
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (20.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater → Marine Microbial Communities From The Costa Rica Dome And Surrounding Waters

Source Dataset Sampling Location

• Location Name: The Central Pacific Ocean
• Coordinates
  • Lat. (^o): 10.0
  • Long. (^o): -145.0
  • Depth (m): 60

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055735	Metagenome	138	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0160422_100251513	F055735	GGAGG	LNKKPIKNYQHQLAELQKQYFFENMDKKEYCVRYDAINKRLSELENEKR*