Scaffold Ga0079063_1026372

Overview

Basic Information

• Taxon OID: 3300012881
• Scaffold ID: Ga0079063_1026372
• Source Dataset Name: Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Gel_02_SludgeMetaT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2534
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (80.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: USA: Illinois
• Coordinates
  • Lat. (^o): 40.1191
  • Long. (^o): -88.1952

Associated Families

Family	Category	Number of Sequences	3D Structure?
F092293	Metagenome / Metatranscriptome	107	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0079063_10263725	F092293	GAGG	MTRPPTLTDRQIQIIRENLDLFPADILKLPEFADTDVTRHTIRNYQRRLKNAAVIDEEEDLLARLKKYMDRHGLESQFHGPRGVTGFIRHLETKIHLRAIERDNSENRAA*