Scaffold Ga0079063_1006791

Overview

Basic Information

• Taxon OID: 3300012881
• Scaffold ID: Ga0079063_1006791
• Source Dataset Name: Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Gel_02_SludgeMetaT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 626
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin035 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location

• Location Name: USA: Illinois
• Coordinates
  • Lat. (^o): 40.1191
  • Long. (^o): -88.1952

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013091	Metagenome / Metatranscriptome	274	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0079063_10067912	F013091	AGGAGG	MSCKLTNGINLKDCDTPGGVSESYFINIEDVDTMTVSDFQVSALTLKSTTKAYKIAFEPQTSNFASNAVGSVENSSAAFEQACEIKINKVDNNVLAQIDALTKGRHLVIIKKADGTYEMYFHEGGAKFLANYTTGTAFEDPSGVTLTATHRQPSNMLLVSATVMASL