Scaffold Ga0160504_1003187

Overview

Basic Information

• Taxon OID: 3300012879
• Scaffold ID: Ga0160504_1003187
• Source Dataset Name: Enriched soil microbial communities from UW Madison campus, WI, USA - DID2937_E24_Xylan MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4876
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (20.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities

Source Dataset Sampling Location

• Location Name: USA: Madison, Wisconsin
• Coordinates
  • Lat. (^o): 43.073
  • Long. (^o): -89.4011

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018299	Metagenome / Metatranscriptome	235	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0160504_10031874	F018299	AGGCGG	MVGDDLNVGTILSEQAFFLKSGVFSLVKLGETPLAGDDDLLSTGELEFTSSESFNSMGNVLFVKSDGVEDLVNLNSGDFTNGLTEGTSHTSLESIGTSAGKHLVNSEDVPRVNSASKMETFLTALLDQVLVGSNTSSFHGFGGDLFLFERNEVNTEGEFFDFSLLFTGIINSDSGIGDTSVITRLGERLATPVSVASSGSSSHFMTLFSLISIKLY*