Scaffold Ga0138283_1259285

Overview

Basic Information

• Taxon OID: 3300012774
• Scaffold ID: Ga0138283_1259285
• Source Dataset Name: Freshwater microbial communities from Lake Simoncouche, Canada - S_130109_E_mt (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1894
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location

• Location Name: Canada: Quebec
• Coordinates
  • Lat. (^o): 48.2311
  • Long. (^o): -71.2508

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067419	Metagenome / Metatranscriptome	125	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0138283_12592852	F067419	N/A	MESNKKSRYVSAMDLSYKDGIERPFIEIGQTVWVADNSGVKKVKISKWLTQSVYLVEVMVVRSGYEKKVPIGTELCAVLVRFKDFGYYSSDQVCLFKTHHLLPNYFGGAPMFTHIYGGTVSPRNDLVHYRTILNACRLQPNDYIRVDLETYAKVQKITKFKQGLDGSEFEVVLTSGNRFFNETGFKKGQLVKGVLRRRPFRTNVTTTSLLSYPFDVYQLDISPLAAQ*