Scaffold Ga0138287_1124779

Overview

Basic Information

• Taxon OID: 3300012772
• Scaffold ID: Ga0138287_1124779
• Source Dataset Name: Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_E_mt (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 545
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina brevifila (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location

• Location Name: Canada: Quebec
• Coordinates
  • Lat. (^o): 48.2311
  • Long. (^o): -71.2508

Associated Families

Family	Category	Number of Sequences	3D Structure?
F063743	Metagenome / Metatranscriptome	129	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0138287_11247791	F063743	N/A	EKGVHDLLQKHFSELSLIFLAYCRSLLGSDSAEDAMEMEMAEFHDFVSECGLETKLITFDLMSNMFIKANATNSAQVRDQHAESRRSSETKLDHLQKGDQRMTTGRTTEEKGKVKSKSDGTEAKKDAELVLYEFINMLVRIGFQRANPTFGNFGDKSKLVELPGCLERMIIDEILPRARR