NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0157624_1130971

Scaffold Ga0157624_1130971


Overview

Basic Information
Taxon OID3300012764 Open in IMG/M
Scaffold IDGa0157624_1130971 Open in IMG/M
Source Dataset NameEutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES155 metaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)748
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.099Long. (o)-89.405Alt. (m)Depth (m)7
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F053129Metagenome / Metatranscriptome141N
F081035Metagenome / Metatranscriptome114N

Sequences

Protein IDFamilyRBSSequence
Ga0157624_11309711F081035N/APRMEQKYRDLYTFRSWLRDAFNGAVTISGEAVQVAVTSTTMGTDTYADQDYLTVSATAEVTVYETIAYTA*
Ga0157624_11309712F053129AGGAGMATYGAKALTRIAAASQTGFGTAASIGTATGEILFADAVGTIDLGVTVDLGEDTSVGKRTPIQAGRVSITGKNPVITLAESAASLRTLPLFFDAIGATTAGTAAPYSWTWSPNQSDVDTPIFYSMLVTDGVQKYRVTDAIPTEITLSADASGLLQAGATFGATSVATSSLSFP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.