Scaffold Ga0157607_1148798

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0157607_1148798

Scaffold Ga0157607_1148798

Overview

Basic Information
Taxon OID	3300012711 Open in IMG/M
Scaffold ID	Ga0157607_1148798 Open in IMG/M
Source Dataset Name	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES133 metaT (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	700
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa

Source Dataset Sampling Location
Location Name	USA: Wisconsin
Coordinates	Lat. (^o)	43.099	Long. (^o)	-89.405	Alt. (m)		Depth (m)	7
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047478	Metagenome / Metatranscriptome	149	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0157607_11487981	F047478	N/A	SRPVAPALPAAGEVGAAAAGTARQASGGSGSCSSYKIPRLLSPIQGGYLENFQALPGVLDDCIIRVPETVQDKFFFSVLMESGLMLSGRAAREYSGAHFKFQRKPERQRK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.