Scaffold Ga0157595_1160154

Overview

Basic Information

• Taxon OID: 3300012708
• Scaffold ID: Ga0157595_1160154
• Source Dataset Name: Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES113 metaT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 738
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Oligotrophic, Dystrophic, And Eutrophic Lakes In Wisonsin, Usa

Source Dataset Sampling Location

• Location Name: USA: Wisconsin
• Coordinates
  • Lat. (^o): 43.099
  • Long. (^o): -89.405
  • Depth (m): 7

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028164	Metagenome / Metatranscriptome	192	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0157595_11601541	F028164	AGGA	MSLCTVAELKSVLGVGSLYPDATIQEVCDASDAVLLPMLWADTHFNTEHSNTTTVGTLYF