Scaffold Ga0136615_10227762

Overview

Basic Information

• Taxon OID: 3300012678
• Scaffold ID: Ga0136615_10227762
• Source Dataset Name: Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ288 (22.06)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 843
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia solanacearum (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand → Polar Desert Microbial Communities From Antarctic Dry Valleys

Source Dataset Sampling Location

• Location Name: Antarctica: Dry Valley
• Coordinates
  • Lat. (^o): -78.0557
  • Long. (^o): 163.7304

Associated Families

Family	Category	Number of Sequences	3D Structure?
F061254	Metagenome	132	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136615_102277621	F061254	N/A	MTAIFLILIAFGALISLVAGVRALRAYLGYRRARAAFRGAVTDEVARLAERTGELESGLSALDARAAELPIQISELQQSLTSLRVLTGALSASLRQVQKVLSYSALKTLSAARLGRLLRFPPVPKSDEHPGDHSPG*