NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0157210_1031381

Scaffold Ga0157210_1031381


Overview

Basic Information
Taxon OID3300012665 Open in IMG/M
Scaffold IDGa0157210_1031381 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Talbot River, Ontario, Canada - S11
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMolecular Research LP (MR DNA)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)831
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Freshwater Microbial Communities From Rivers And Streams Along An Organic Matter Gradient Associated With Agriculture In Ontario, Canada

Source Dataset Sampling Location
Location NameDouro-Dummer, Ontario
CoordinatesLat. (o)44.4982Long. (o)-79.1546Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F080905Metagenome114N

Sequences

Protein IDFamilyRBSSequence
Ga0157210_10313811F080905N/AMTDSHKKSKDEAINISKLHEHIKNSTTSGIKIKTAFACEFPHQNMFTSTVMSGANRSTHHDLQIELDGALKTVEFKGSMHFKQIDSTKAPWTNGVQFYNGPGNKFKVGSLYAKKFYDECIDKIIVDLDIKTPKPSYEEWVKDAFRQGKPKTPFVCELREKGYCGDYLSDARKQFNKSFMLSTFELTDLMLEVQKISEEVLNCKDFWLQIHGDIDDPDKFHV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.