Scaffold Ga0157203_1004388

Overview

Basic Information

• Taxon OID: 3300012663
• Scaffold ID: Ga0157203_1004388
• Source Dataset Name: Freshwater microbial communities from Indian River, Ontario, Canada - S50
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Molecular Research LP (MR DNA)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2815
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Freshwater Microbial Communities From Rivers And Streams Along An Organic Matter Gradient Associated With Agriculture In Ontario, Canada

Source Dataset Sampling Location

• Location Name: Warsaw, Ontario
• Coordinates
  • Lat. (^o): 44.42735
  • Long. (^o): -78.1359

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021968	Metagenome / Metatranscriptome	216	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0157203_10043885	F021968	N/A	EKIKSLAESVEFSTEDEYKSKLDTIRENYFPSGAKKATESQLNEQFEETEEKKVIHDPFVAAVSQAISKTKF*