Scaffold Ga0118248_107510

Overview

Basic Information

• Taxon OID: 3300012607
• Scaffold ID: Ga0118248_107510
• Source Dataset Name: Human skin bacterial and viral communities - University of Pennsylvania - MG100535
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Pennsylvania
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 550
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Skin → Unclassified → Unclassified → Human Skin → Human Skin Bacterial And Viral Communities - University Of Pennsylvania

Source Dataset Sampling Location

• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027342	Metagenome	195	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0118248_1075101	F027342	N/A	LPCSVSDAAALYRGEVGSSTEKVFWSQYAEAGHPVPPSDQLKQLVELHKVAEQAMKGLIVRLWPKEAMPESYFGLVRRLVDVCPWIEVVKCSVCIEGARRALARAKVHWGKLDAEKLLTDAPPPGKEYRTPEMYYKGVLKGARLIAGECSKDVIFE*