Scaffold Ga0136635_10106552

Overview

Basic Information

• Taxon OID: 3300012530
• Scaffold ID: Ga0136635_10106552
• Source Dataset Name: Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 896
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand → Polar Desert Microbial Communities From Antarctic Dry Valleys

Source Dataset Sampling Location

• Location Name: Antarctica: Dry Valley
• Coordinates
  • Lat. (^o): -78.0243
  • Long. (^o): 163.9173

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072884	Metagenome	121	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136635_101065521	F072884	N/A	MFYSTLKESNQLVAETKNTVSNLSKKEFILMGFGEHTSAIAFVSSEPEANITAQFGRIRGEKFSLVAFEAAWLLGGNMSKEVSDWLDRHKPSPFKTANGKSTA*