Scaffold Ga0136635_10019615

Overview

Basic Information

• Taxon OID: 3300012530
• Scaffold ID: Ga0136635_10019615
• Source Dataset Name: Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1996
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Sporichthyales → Sporichthyaceae → unclassified Sporichthyaceae → Sporichthyaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand → Polar Desert Microbial Communities From Antarctic Dry Valleys

Source Dataset Sampling Location

• Location Name: Antarctica: Dry Valley
• Coordinates
  • Lat. (^o): -78.0243
  • Long. (^o): 163.9173

Associated Families

Family	Category	Number of Sequences	3D Structure?
F049447	Metagenome / Metatranscriptome	146	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136635_100196152	F049447	GGA	VTHLLIAHVVLGLVALLVVAFVAFPYRGRSVPRAERLTDAVAAVADRVTPGEAPPLGVLTSPEKSRAMSKRFERVEGHVRRGARVVVSAGRN*