Scaffold Ga0129331_1529955

Overview

Basic Information

• Taxon OID: 3300012524
• Scaffold ID: Ga0129331_1529955
• Source Dataset Name: Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 692
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location

• Location Name: USA: Chesapeake Bay
• Coordinates
  • Lat. (^o): 37.1043
  • Long. (^o): -76.1811

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007295	Metagenome / Metatranscriptome	353	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0129331_15299551	F007295	N/A	EADFVCCDSGYFCAATQADCPTPNVIEKETKQDCDGTVCPGGCCPNAGWFCCPGDEYCAASEEYCKKADFAKILMSMAAPKKVVKQDCEGTVCPGGCCPNAGWFCCPGDEYCAASEEYCKKTNIAEKLISMAAAKKIVKQDCEGTVCPGGCCPNAGWFCCPGDEYCAASEEYCKKADFGKIILSMAAPKKIVKKEAKQDCEGTVCPGGCCPNAGWFCCPGDEYCAASEEY