Scaffold Ga0157313_1043502

Overview

Basic Information

• Taxon OID: 3300012503
• Scaffold ID: Ga0157313_1043502
• Source Dataset Name: Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 560
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations

Source Dataset Sampling Location

• Location Name: USA: North Carolina
• Coordinates
  • Lat. (^o): 35.9076
  • Long. (^o): -79.0506
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055926	Metagenome / Metatranscriptome	138	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0157313_10435021	F055926	N/A	APKPAAILLQVSDISEASGLDPGSLERAMARRSGGEGQVARALGVRPRGARP*