Scaffold Ga0157349_1033841

Overview

Basic Information

• Taxon OID: 3300012489
• Scaffold ID: Ga0157349_1033841
• Source Dataset Name: Unplanted soil (control) microbial communities from North Carolina - M.Soil.5.yng.040610
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 546
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations

Source Dataset Sampling Location

• Location Name: USA: North Carolina
• Coordinates
  • Lat. (^o): 35.9076
  • Long. (^o): -79.0506
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071118	Metagenome	122	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0157349_10338412	F071118	AGG	MKSDIEQIIDARVAVVFDDILPHGGSDARSEVLKGARDLVRTVWISKIYNALPKDKTTIPEYFLDAELEQFLNETIEECYSVIA