Scaffold Ga0157346_1018989

Overview

Basic Information

• Taxon OID: 3300012480
• Scaffold ID: Ga0157346_1018989
• Source Dataset Name: Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 584
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations

Source Dataset Sampling Location

• Location Name: USA: North Carolina
• Coordinates
  • Lat. (^o): 35.9076
  • Long. (^o): -79.0506
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F069770	Metagenome	123	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0157346_10189891	F069770	N/A	GGGRYSNFGLWPVVNAKGAIAFTAAVDGGPSPVIAVRVAAGAPRRVVGVGDSVPGGERIASLSLLPVVSIGAGGDLTFAVTPTTAGSGPEGLFVAAAAEP*