Scaffold Ga0150984_122115116

Overview

Basic Information

• Taxon OID: 3300012469
• Scaffold ID: Ga0150984_122115116
• Source Dataset Name: Combined assembly of Soil carbon rhizosphere
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1513
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere → Avena Fatua Rhizosphere Microbial Communities From Hopland, California, Usa, For Root-Enhanced Decomposition Of Organic Matter Studies

Source Dataset Sampling Location

• Location Name: Hopland, California, USA
• Coordinates
  • Lat. (^o): 38.97364
  • Long. (^o): -123.117453
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087716	Metagenome / Metatranscriptome	110	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0150984_1221151163	F087716	GAG	VAKERPGWRVVDFIEVNDESGPSFEVTIENGGRRTTLLLTEGKQIVSERR*