Scaffold Ga0138261_1276322

Overview

Basic Information

• Taxon OID: 3300012418
• Scaffold ID: Ga0138261_1276322
• Source Dataset Name: Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA12.A_72.20151113 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 705
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine → Polar Marine Prokaryotic And Eukaryotic Communities From Antarctica During Spring Seasonal Transition

Source Dataset Sampling Location

• Location Name: Antarctica
• Coordinates
  • Lat. (^o): -64.775
  • Long. (^o): -64.053
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011359	Metagenome / Metatranscriptome	291	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0138261_12763222	F011359	N/A	MASFRGMCVAFIVVLLSLGMQGCEKSNLCKQSIPLLGSLTCKLAAVGPGACGDLKGASISKADSVSACQDLCTKKKGCKYYSFCTDPADKKTCSALYRGACGLIVNDKCKLATSLARGGLTTFQMYDANMHTPHSQTAQTGMGFMLGLAAAGAFAMVWVRFGRRSTQHQDMELLEEVNCEE*