Scaffold Ga0134022_1005267

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0134022_1005267

Scaffold Ga0134022_1005267

Overview

Basic Information
Taxon OID	3300012371 Open in IMG/M
Scaffold ID	Ga0134022_1005267 Open in IMG/M
Source Dataset Name	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_1 metaT (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	568
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil → Grasslands Soil Microbial Communities From The Angelo Coastal Reserve, California, Usa

Source Dataset Sampling Location
Location Name	USA: Angelo Coastal Reserve, California
Coordinates	Lat. (^o)	39.7181	Long. (^o)	-123.6527	Alt. (m)		Depth (m)	.2
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030100	Metagenome / Metatranscriptome	186	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0134022_10052671	F030100	N/A	LRWAAAVNRLQLNVSRILPGDWGKVESGWLAQLLSDRIIGFGKGGRIHQFLWRRSRAVSKREKGTERQGAIRNRSEPSLVAQDQFRA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.