Basic Information | |
---|---|
Taxon OID | 3300012361 Open in IMG/M |
Scaffold ID | Ga0137360_10869968 Open in IMG/M |
Source Dataset Name | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 776 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil → Vadose Zone Soil And Rhizosphere Microbial Communities From The Eel River Critical Zone Observatory, Northern California To Study Diel Carbon Cycling |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California | |||||||
Coordinates | Lat. (o) | 39.7291 | Long. (o) | -123.6419 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F014653 | Metagenome / Metatranscriptome | 261 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0137360_108699681 | F014653 | N/A | GELASSFKQAAALADAQGKERAEQAYIHLDLMPYYQREYSPVFQSCLTSTDHPDPSPFPFVAAIGKDGRVLRLYIDHETNIYACVRQTLQQDEFPHPPVSPYYLHVSMNFSK* |
⦗Top⦘ |