Scaffold Ga0157138_1024552

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0157138_1024552

Scaffold Ga0157138_1024552

Overview

Basic Information
Taxon OID	3300012352 Open in IMG/M
Scaffold ID	Ga0157138_1024552 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Molecular Research LP (MR DNA)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	964
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Freshwater Microbial Communities From Rivers And Streams Along An Organic Matter Gradient Associated With Agriculture In Ontario, Canada

Source Dataset Sampling Location
Location Name	Fraserville, Ontario
Coordinates	Lat. (^o)	44.16961	Long. (^o)	-78.4089	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012775	Metagenome	277	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0157138_10245523	F012775	AGG	MKLFSQITRPLIALGLKVRSRKWPEDYYIYRKDEKLMDSLGNEFYYSWEEFIRLQQEVINNGGPIWEIYEEVDYQNL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.