Scaffold Ga0157139_1000798

Overview

Basic Information

• Taxon OID: 3300012345
• Scaffold ID: Ga0157139_1000798
• Source Dataset Name: Freshwater microbial communities from Burnt River, Ontario, Canada - S22
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Molecular Research LP (MR DNA)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1344
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Freshwater Microbial Communities From Rivers And Streams Along An Organic Matter Gradient Associated With Agriculture In Ontario, Canada

Source Dataset Sampling Location

• Location Name: Kawartha Lakes, Ontario
• Coordinates
  • Lat. (^o): 44.74057
  • Long. (^o): -78.6591

Associated Families

Family	Category	Number of Sequences	3D Structure?
F049635	Metagenome / Metatranscriptome	146	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0157139_10007984	F049635	N/A	MNKAIYKTPFGRLVKINFKTMQNFKNVLRISDPTARLYVAHPERMRIKDFNNICLHTGLSREEVFSTFTPTKLINEEND*