Scaffold Ga0150985_110161129

Overview

Basic Information

• Taxon OID: 3300012212
• Scaffold ID: Ga0150985_110161129
• Source Dataset Name: Combined assembly of Hopland grassland soil
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 655
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Beijerinckia → unclassified Beijerinckia → Beijerinckia sp. L45 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere → Avena Fatua Rhizosphere Microbial Communities From Hopland, California, Usa

Source Dataset Sampling Location

• Location Name: Hopland, California, USA
• Coordinates
  • Lat. (^o): 38.972988
  • Long. (^o): -123.116539

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060194	Metagenome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0150985_1101611291	F060194	GGAG	MNEDLNVNSLADVLEKLEKGKIGHHAAMQWLNVKSYDELVEIMHTNGRLMPGHQPMRVAPETRALVRRIFRPAARSK*