Scaffold Ga0136598_1027729

Overview

Basic Information

• Taxon OID: 3300012170
• Scaffold ID: Ga0136598_1027729
• Source Dataset Name: Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Torckler E11 #899
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1257
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Psychrobacter (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location

• Location Name: Antarctica: Rauer Islands
• Coordinates
  • Lat. (^o): -68.5558
  • Long. (^o): 78.1913

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014347	Metagenome	263	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136598_10277292	F014347	N/A	MPDATSDTRMLSMLVCVSAVFVNASVKSPPFTLSKMFAGKLVRLEQSRQVWLKLVPADVSIRGKLVRLVQLYQAAKKLVPADVSIRGKLVRLVQ*