Scaffold Ga0153953_1100726

Overview

Basic Information

• Taxon OID: 3300012154
• Scaffold ID: Ga0153953_1100726
• Source Dataset Name: Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ037 MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 516
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa

Source Dataset Sampling Location

• Location Name: USA: New Jersey, Wharton State Forest
• Coordinates
  • Lat. (^o): 39.746
  • Long. (^o): -74.7609

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011544	Metagenome / Metatranscriptome	290	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0153953_11007263	F011544	N/A	YRDLADRLGMPASWPIVVADYDRVVVTCSARDGTVCVLRPPGHDPAAVLKAARLVLPEDPYQELADQLGVPASLPAD*