Scaffold Ga0153953_1092629

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0153953_1092629

Scaffold Ga0153953_1092629

Overview

Basic Information
Taxon OID	3300012154 Open in IMG/M
Scaffold ID	Ga0153953_1092629 Open in IMG/M
Source Dataset Name	Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ037 MetaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	541
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa

Source Dataset Sampling Location
Location Name	USA: New Jersey, Wharton State Forest
Coordinates	Lat. (^o)	39.746	Long. (^o)	-74.7609	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F070730	Metagenome	122	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0153953_10926291	F070730	N/A	MDNFCLQSCNPVIYGGQGTIIIVDCSIEHLVNVVLEKKRSFLIYILQHLYLSLISGHVLSAYAIFDKCIPILSTKIRKGNSSGKVVESRHIYLSN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.