Scaffold Ga0154006_1002869

Overview

Basic Information

• Taxon OID: 3300012125
• Scaffold ID: Ga0154006_1002869
• Source Dataset Name: Attine ant fungus gardens microbial communities from Florida, USA - TSFL090 MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5524
• Total Scaffold Genes: 16
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 10 (62.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa

Source Dataset Sampling Location

• Location Name: USA: Florida, Wakulla State Forest
• Coordinates
  • Lat. (^o): 30.3423
  • Long. (^o): -84.2548

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079422	Metagenome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0154006_10028698	F079422	GAGG	VKEDVWKKGVRKNASAKDLGPCHRIERGVHAKKGKSIFIVEGEKRRSTSICERSVEKRIHLAFQVAPNITSTLRGKKGWHTENGVGLSIHKSVDDKEWISFIPYCRYTG*