NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0120191_10121065

Scaffold Ga0120191_10121065


Overview

Basic Information
Taxon OID3300012022 Open in IMG/M
Scaffold IDGa0120191_10121065 Open in IMG/M
Source Dataset NameTerrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterGeorgia Institute of Technology
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)566
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial → Terrestrial Microbial Communites From A Soil Warming Plot In Okalahoma, Usa

Source Dataset Sampling Location
Location NameUSA: Kessler Farm Field Laboratory (KFFL), Okalahoma
CoordinatesLat. (o)34.975667Long. (o)-97.519Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004876Metagenome / Metatranscriptome420Y

Sequences

Protein IDFamilyRBSSequence
Ga0120191_101210652F004876AGAAGMQKSHGTLDVNWAPVSSSKEKKDADSGERGAQRQKRSKDKLIRLDDLIPDEKVVGGRQLFGATDTTQNQKPN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.