NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0120191_10002131

Scaffold Ga0120191_10002131


Overview

Basic Information
Taxon OID3300012022 Open in IMG/M
Scaffold IDGa0120191_10002131 Open in IMG/M
Source Dataset NameTerrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterGeorgia Institute of Technology
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1818
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial → Terrestrial Microbial Communites From A Soil Warming Plot In Okalahoma, Usa

Source Dataset Sampling Location
Location NameUSA: Kessler Farm Field Laboratory (KFFL), Okalahoma
CoordinatesLat. (o)34.975667Long. (o)-97.519Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005163Metagenome / Metatranscriptome410Y
F064584Metagenome / Metatranscriptome128N

Sequences

Protein IDFamilyRBSSequence
Ga0120191_100021312F064584N/AMTAKNMKRLSITLCGLIGLAAYAHAAPVLKLEKIKQIVCESTVSYDEDSPNEKTAARGVKIFKPGSRKDVKPRAGAFLLAELDPDGSDQDAFDQQFYFSPIRGGKLSFRFLAAWKAHGELNLGADGTATGFINQKSHITELRCKIHSK*
Ga0120191_100021313F005163GGAMRYITIVALAFAFAGSAHAANNDLKAAGKGGEEDTARKAAERSAQEIARAEIYWLDTAYRRSDGALIQEQRQFLRNKADLRFLPPFSSLAECQAEAQYRMNWRGGKDSPIFERADCRPTAITLKMLNAVRRDHCWEDRKRPAWERPECRAAVEALSNILEKELKAK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.