Scaffold Ga0120192_10147719

Overview

Basic Information

• Taxon OID: 3300012021
• Scaffold ID: Ga0120192_10147719
• Source Dataset Name: Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Georgia Institute of Technology
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 512
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial → Terrestrial Microbial Communites From A Soil Warming Plot In Okalahoma, Usa

Source Dataset Sampling Location

• Location Name: USA: Kessler Farm Field Laboratory (KFFL), Okalahoma
• Coordinates
  • Lat. (^o): 34.975667
  • Long. (^o): -97.519

Associated Families

Family	Category	Number of Sequences	3D Structure?
F097287	Metagenome / Metatranscriptome	104	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0120192_101477191	F097287	AGG	VAARPGVESLPTSGGPTTAHPQTDYYRLRTECLRYKSQLFDGLTGLPALPAVLEGVRRIVESCGAADVVYLDLGRSGGHETKLGWAAYDGAVREFASLLTALQASGELDGRD