Scaffold Ga0153801_1102170

Overview

Basic Information

• Taxon OID: 3300012017
• Scaffold ID: Ga0153801_1102170
• Source Dataset Name: Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Molecular Research LP (MR DNA)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 506
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Central Basin Lake Erie, Ontario, Canada

Source Dataset Sampling Location

• Location Name: Ontario, Canada
• Coordinates
  • Lat. (^o): 42.6244481
  • Long. (^o): -80.9227115
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034091	Metagenome / Metatranscriptome	175	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0153801_11021701	F034091	N/A	RYLVDLERIKLTAEELLGYATATGEFYGLMEEWQNRSWDLGYPISHWIVEINAAQRFLLAHDFVRKWQARHHSNIVPHTTSRNKLDDNLGVEALLPPLWRAGSVRLPTMRDNWKTLAFIDEMTSWSRDKKNGTDLVMAHWFSELHMPQLSPLKAPPKLWRPSWY*