NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0153801_1026618

Scaffold Ga0153801_1026618


Overview

Basic Information
Taxon OID3300012017 Open in IMG/M
Scaffold IDGa0153801_1026618 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMolecular Research LP (MR DNA)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1024
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Central Basin Lake Erie, Ontario, Canada

Source Dataset Sampling Location
Location NameOntario, Canada
CoordinatesLat. (o)42.6244481Long. (o)-80.9227115Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F047571Metagenome149Y

Sequences

Protein IDFamilyRBSSequence
Ga0153801_10266182F047571AGAAGMVSVLYSFSFNGQVFGGAGSPYQIQSVEGLESLPEIRRQDDNRGYADGMFSGRDFLGGRSIFITFLTLGSGSNTAQENYNTIQSYLLPQTSGTTPLFFMLDGTQQYIDARVRGLRTTLDPNYTYG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.