Scaffold Ga0153801_1008971

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0153801_1008971

Scaffold Ga0153801_1008971

Overview

Basic Information
Taxon OID	3300012017 Open in IMG/M
Scaffold ID	Ga0153801_1008971 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Molecular Research LP (MR DNA)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1835
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Central Basin Lake Erie, Ontario, Canada

Source Dataset Sampling Location
Location Name	Ontario, Canada
Coordinates	Lat. (^o)	42.6244481	Long. (^o)	-80.9227115	Alt. (m)		Depth (m)	1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004760	Metagenome / Metatranscriptome	424	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0153801_10089713	F004760	AGGA	MPVYQYEDSRNGKVVELEKAVAERDSVPRYLKRFTVPQRLSLVGVGEPLDNPLGVNQTNLMKGYYRQEQKLGSRFKSKFTPDSIKRATLRRK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.