NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0153801_1001061

Scaffold Ga0153801_1001061


Overview

Basic Information
Taxon OID3300012017 Open in IMG/M
Scaffold IDGa0153801_1001061 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMolecular Research LP (MR DNA)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6018
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (55.56%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Central Basin Lake Erie, Ontario, Canada

Source Dataset Sampling Location
Location NameOntario, Canada
CoordinatesLat. (o)42.6244481Long. (o)-80.9227115Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F034855Metagenome / Metatranscriptome173Y
F093270Metagenome106N

Sequences

Protein IDFamilyRBSSequence
Ga0153801_10010615F093270AGGAMPDIQTALKTAIDAWEPTPTGQQLKEKLMQNRPVFEVQNNVTRVTFDYIKLHPGTTSTAASRDLAKHGFKESSVTALMAQFVRAGLAVRDNNHGYRVTVDEYTPMKASVKYAKKTVVKAKPAPKAREPQNDGIAALQPEATSKRVVNTIVFGKPPEEVVKHMNVIQARELYDYLKKMFGG
Ga0153801_10010616F034855N/ALEVKMDDTRMENAIKLAEKCWSKAMKEEPEFVEQYLKLAEQLLCTKPVVLGDEFREYCAKHKLRRPASLHPNVWVSGVRALKTIGWVSHAGYTAPTKSHNHMPSVSMWNSMIFSNRWTQCVGEMDSEE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.