Scaffold Ga0153799_1012317

Overview

Basic Information

• Taxon OID: 3300012012
• Scaffold ID: Ga0153799_1012317
• Source Dataset Name: Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Molecular Research LP (MR DNA)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1847
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Central Basin Lake Erie, Ontario, Canada

Source Dataset Sampling Location

• Location Name: Ontario, Canada
• Coordinates
  • Lat. (^o): 42.581667
  • Long. (^o): -79.9225
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072267	Metagenome / Metatranscriptome	121	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0153799_10123174	F072267	AGAAGG	MTEKIGYKLNLNKLKGAPQSILPYFVGAFYYTEDFEYFDVIKPYLDIPEKPKTLEEISQEFDAKIDKRIERVKEQFNQLGYTQEYQYQVKFNRIIENFEYAKEHGQFPVTLTVGTSLDYSNLIATGSNITSSFVIKQGNKHEGYYTFGNCRSFKYYMPTKPNFIVRFFMKNLLGFFWVDEK*