Scaffold Ga0120118_1078751

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0120118_1078751

Scaffold Ga0120118_1078751

Overview

Basic Information
Taxon OID	3300012010 Open in IMG/M
Scaffold ID	Ga0120118_1078751 Open in IMG/M
Source Dataset Name	Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Tennessee
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	810
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost Microbial Communities From Nunavut, Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location Name	Canada: Axel Heiberg Island, Nunavut
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)	.35
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017937	Metagenome / Metatranscriptome	238	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0120118_10787511	F017937	GGA	MIMKTISRVIESMLTKDATQQWTGQTSAVQSRDTWSWGGFSDQAATVF*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.