 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300012009 Open in IMG/M |
| Scaffold ID | Ga0153773_1082546 Open in IMG/M |
| Source Dataset Name | Saline lake microbial mat microbial communities from La Brava Lake, II Region de Antofagasta, Chile - La Brava 201312 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | INDEAR Instituto de Agrobiotecnologia Rosario |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2214 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (20.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Saline Lake Microbial Mat → Saline Lake Microbial Mat Microbial Communities From La Brava Lake, Ii Region De Antofagasta, Chile |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | II Region de Antofagasta, Chile | |||||||
| Coordinates | Lat. (o) | -23.730056 | Long. (o) | -68.246861 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F015419 | Metagenome / Metatranscriptome | 255 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0153773_10825464 | F015419 | N/A | MKYELKVTDENGNEYSYNVMRSSFDESKNLNDFILEALSISEDKRRLPFMIQCPNGLEVHPSLKMKFENYGSSLLGDKLEAMMVTWRD* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |