Scaffold Ga0120380_1016302

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0120380_1016302

Scaffold Ga0120380_1016302

Overview

Basic Information
Taxon OID	3300011989 Open in IMG/M
Scaffold ID	Ga0120380_1016302 Open in IMG/M
Source Dataset Name	Sheep rumen microbial communities from Wyoming, USA - O_aries_Con_7429
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Missouri
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2308
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Sheep Rumen → Ruminant Gut Microbial Communities From Various Locations In Usa

Source Dataset Sampling Location
Location Name	USA: Wyoming
Coordinates	Lat. (^o)	41.314168	Long. (^o)	-105.584589	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013656	Metagenome	269	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0120380_10163022	F013656	AGGA	MTMAKIYKEANKCETETTINVLYSENILSIYTNKVDLERRLYKILGEPKKEYIKGRSVLASLWEIPLDDVSKINKVILRADIYGV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.