Scaffold Ga0120685_1043190

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0120685_1043190

Scaffold Ga0120685_1043190

Overview

Basic Information
Taxon OID	3300011983 Open in IMG/M
Scaffold ID	Ga0120685_1043190 Open in IMG/M
Source Dataset Name	Aquatic prokaryotic and eukaryotic communities from a canal in New York, USA: aquatic canal water -GCSS-10
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Weill Cornell Medical College
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	503
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Built Environment → Canal → Unclassified → Unclassified → Aquatic Canal → Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa

Source Dataset Sampling Location
Location Name	USA:New York City
Coordinates	Lat. (^o)	40.67	Long. (^o)	-73.99	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F092080	Metagenome	107	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0120685_10431901	F092080	N/A	MVLMCIYIPYKGGKGMQDKRVTIRIPFEIWKALRELQTVGKISSIQQAAVTGMNKLIESLKWGEEDNQRGAAKERVLNVLVKEKPLGKWEDIHRERTEADADRS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.