Basic Information | |
---|---|
Taxon OID | 3300011448 Open in IMG/M |
Scaffold ID | Ga0120365_10080 Open in IMG/M |
Source Dataset Name | Fecal viral communites from wild urban brown rats in Berlin, Germany - Mu/10/1772 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Freie University Berlin |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1093 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Fecal → Fecal Viral Communites From Wild Urban Brown Rats In Berlin, Germany |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Germany: Berlin | |||||||
Coordinates | Lat. (o) | 52.529611 | Long. (o) | 13.401343 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F053097 | Metagenome / Metatranscriptome | 141 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0120365_100801 | F053097 | N/A | AIPPFKDFYNKSKDKQDAIKKIEFIIWRYKWNTPYEAYPEKERTWRVAKDVFNDEHYVPDADVQELAKRFNEF* |
⦗Top⦘ |