Scaffold Ga0137433_1014109

Overview

Basic Information

• Taxon OID: 3300011440
• Scaffold ID: Ga0137433_1014109
• Source Dataset Name: Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2339
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location

• Location Name: USA: East River, Colorado
• Coordinates
  • Lat. (^o): 38.8895
  • Long. (^o): -106.9075
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056793	Metagenome	137	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0137433_10141094	F056793	N/A	CLQPSAGLLKSADIVAACGAAATAYLGETKDGAACRLHFQVAGGDAAQTYAMVSHPVIPAGAPAPMGPDPLLPMTWKKITLRDALGFQAVGATNPTLLEKQTQLWAGRGRRIIGLHVSKQLCTPAQAEALLQKVIDAVP*